PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00005059-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NF-YB
Protein Properties Length: 137aa    MW: 15169 Da    PI: 9.834
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00005059-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB106.12.3e-33194194
                  NF-YB  1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90
                           +++q+r++ ianvsrimkk lP na isk +        +    +  + asdkcqrekrktingddllwa++tlGf++yv+plk yl+ y
  SMil_00005059-RA_Salv  1 MKDQERVVAIANVSRIMKKSLPPNANISKGSERNSAGMRVGVHKLRDGGASDKCQREKRKTINGDDLLWAMTTLGFQNYVDPLKDYLTTY 90
                           589****************************999999999999999******************************************** PP

                  NF-YB 91 rele 94
                           r++ 
  SMil_00005059-RA_Salv 91 RDTS 94
                           *975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.5E-26295IPR009072Histone-fold
SuperFamilySSF471131.49E-18593IPR009072Histone-fold
PfamPF008082.4E-45071IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.6E-95472No hitNo description
PRINTSPR006158.6E-97391No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MKDQERVVAI ANVSRIMKKS LPPNANISKG SERNSAGMRV GVHKLRDGGA SDKCQREKRK  60
TINGDDLLWA MTTLGFQNYV DPLKDYLTTY RDTSSPIHDK TKIATANPSF LQGFTSDAGG  120
VVIEFATSSW CXHFINL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-27192192Transcription factor HapC (Eurofung)
4g92_B3e-27192192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012075209.15e-34PREDICTED: nuclear transcription factor Y subunit B-1-like
SwissprotO233102e-33NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A067KTU36e-34A0A067KTU3_JATCU; Uncharacterized protein
STRINGGLYMA05G31681.13e-32(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-34nuclear factor Y, subunit B3